Anti SNRPB pAb (ATL-HPA003482 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA003482-25

Protein Description: small nuclear ribonucleoprotein polypeptides B and B1
Gene Name: SNRPB
Alternative Gene Name: COD, Sm-B/B', SmB/SmB', snRNP-B, SNRPB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000102252: 100%, ENSRNOG00000059764: 100%
Entrez Gene ID: 6628
Uniprot ID: P14678
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TFKAFDKHMNLILCDCDEFRKIKPKNAKQPEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGVGRAAGRGVPAGVPIPQ
• Gene Sequence: TFKAFDKHMNLILCDCDEFRKIKPKNAKQPEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGVGRAAGRGVPAGVPIPQ
• Gene ID - Mouse: ENSMUSG00000102252
• Gene ID - Rat: ENSRNOG00000059764
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SNRPB pAb (ATL-HPA003482 w/enhanced validation) – 2 Found

Jing, Junjie; Zhao, Yang; Wang, Chengfeng; Zhao, Qingshuang; Liang, Qinchuan; Wang, Shousen; Ma, Jie. Effect of small nuclear ribonucleoprotein-associated polypeptide N on the proliferation of medulloblastoma cells. Molecular Medicine Reports. 2015;11(5):3337-43. 

Ji, Meiling; Ren, Li; Lv, Yang; Lao, Xinyuan; Feng, Qingyang; Tang, Wentao; Zhuang, Aobo; Liu, Tianyu; Zheng, Peng; Xu, Jianmin. Small Nuclear Ribonucleoprotein Polypeptide N Accelerates Malignant Progression and Poor Prognosis in Colorectal Cancer Transcriptionally Regulated by E2F8. Frontiers In Oncology. 10( 33224876):561287.