Anti SNRPA1 pAb (ATL-HPA048499)

Atlas Antibodies

SKU: ATL-HPA048499-25

• 
• 

Protein Description: small nuclear ribonucleoprotein polypeptide A'
Gene Name: SNRPA1
Alternative Gene Name: Lea1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030512: 100%, ENSRNOG00000011932: 100%
Entrez Gene ID: 6627
Uniprot ID: P09661
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLK
• Gene Sequence: IEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLK
• Gene ID - Mouse: ENSMUSG00000030512
• Gene ID - Rat: ENSRNOG00000011932
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.