Anti SNRNP40 pAb (ATL-HPA026527 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA026527-25

Protein Description: small nuclear ribonucleoprotein 40kDa (U5)
Gene Name: SNRNP40
Alternative Gene Name: HPRP8BP, PRP8BP, PRPF8BP, SPF38, WDR57
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000106911: 98%, ENSRNOG00000012219: 99%
Entrez Gene ID: 9410
Uniprot ID: Q96DI7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QGNVHNFEKNLLRCSWSPDGSKIAAGSADRFVYVWDTTSRRILYKLPGHAGSINEVAFHPDEPIIISASSDKRLYMGEIQ
• Gene Sequence: QGNVHNFEKNLLRCSWSPDGSKIAAGSADRFVYVWDTTSRRILYKLPGHAGSINEVAFHPDEPIIISASSDKRLYMGEIQ
• Gene ID - Mouse: ENSMUSG00000106911
• Gene ID - Rat: ENSRNOG00000012219
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SNRNP40 pAb (ATL-HPA026527 w/enhanced validation) – 2 Found

Nguyen, Alexander; Yoshida, Mitsukuni; Goodarzi, Hani; Tavazoie, Sohail F. Highly variable cancer subpopulations that exhibit enhanced transcriptome variability and metastatic fitness. Nature Communications. 2016;7( 27138336):11246. 

Olthof, Anouk M; White, Alisa K; Mieruszynski, Stephen; Doggett, Karen; Lee, Madisen F; Chakroun, Almahdi; Abdel Aleem, Alice K; Rousseau, Justine; Magnani, Cinzia; Roifman, Chaim M; Campeau, Philippe M; Heath, Joan K; Kanadia, Rahul N. Disruption of exon-bridging interactions between the minor and major spliceosomes results in alternative splicing around minor introns. Nucleic Acids Research. 2021;49(6):3524-3545.