Anti SNRNP35 pAb (ATL-HPA067031)

Atlas Antibodies

Catalog No.:
ATL-HPA067031-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: small nuclear ribonucleoprotein 35kDa (U11/U12)
Gene Name: SNRNP35
Alternative Gene Name: U1SNRNPBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029402: 94%, ENSRNOG00000001060: 94%
Entrez Gene ID: 11066
Uniprot ID: Q16560
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LGGGLGGKKESGQLRFGGRDRPFRKPINLPVVKNDLYREGKRERRERS
Gene Sequence LGGGLGGKKESGQLRFGGRDRPFRKPINLPVVKNDLYREGKRERRERS
Gene ID - Mouse ENSMUSG00000029402
Gene ID - Rat ENSRNOG00000001060
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SNRNP35 pAb (ATL-HPA067031)
Datasheet Anti SNRNP35 pAb (ATL-HPA067031) Datasheet (External Link)
Vendor Page Anti SNRNP35 pAb (ATL-HPA067031) at Atlas Antibodies

Documents & Links for Anti SNRNP35 pAb (ATL-HPA067031)
Datasheet Anti SNRNP35 pAb (ATL-HPA067031) Datasheet (External Link)
Vendor Page Anti SNRNP35 pAb (ATL-HPA067031)