Anti SNRNP200 pAb (ATL-HPA029321)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029321-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: SNRNP200
Alternative Gene Name: ASCC3L1, BRR2, HELIC2, KIAA0788, RP33, U5-200KD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003660: 98%, ENSRNOG00000012157: 100%
Entrez Gene ID: 23020
Uniprot ID: O75643
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDRECENQLVLLLGFNTFDFIKVLRQHRMMILYCTLLASAQSEAEKERIMGKMEADPELSKFLY |
| Gene Sequence | LHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDRECENQLVLLLGFNTFDFIKVLRQHRMMILYCTLLASAQSEAEKERIMGKMEADPELSKFLY |
| Gene ID - Mouse | ENSMUSG00000003660 |
| Gene ID - Rat | ENSRNOG00000012157 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SNRNP200 pAb (ATL-HPA029321) | |
| Datasheet | Anti SNRNP200 pAb (ATL-HPA029321) Datasheet (External Link) |
| Vendor Page | Anti SNRNP200 pAb (ATL-HPA029321) at Atlas Antibodies |
| Documents & Links for Anti SNRNP200 pAb (ATL-HPA029321) | |
| Datasheet | Anti SNRNP200 pAb (ATL-HPA029321) Datasheet (External Link) |
| Vendor Page | Anti SNRNP200 pAb (ATL-HPA029321) |
| Citations for Anti SNRNP200 pAb (ATL-HPA029321) – 3 Found |
| Shakyawar, Dhruv Kumar; Muralikrishna, Bhattiprolu; Radha, Vegesna. C3G dynamically associates with nuclear speckles and regulates mRNA splicing. Molecular Biology Of The Cell. 2018;29(9):1111-1124. PubMed |
| Rysenkova, Karina D; Troyanovskiy, Konstantin E; Klimovich, Polina S; Bulyakova, Taisiya R; Shelomentseva, Ekaterina M; Shmakova, Anna A; Tanygina, Daria Yu; Ivashkina, Olga I; Anokhin, Konstantin V; Karagyaur, Maxim N; Zvereva, Maria I; Rubina, Kseniya A; Tkachuk, Vsevolod A; Semina, Ekaterina V. Identification of a Novel Small RNA Encoded in the Mouse Urokinase Receptor uPAR Gene (Plaur) and Its Molecular Target Mef2d. Frontiers In Molecular Neuroscience. 15( 35875662):865858. PubMed |
| Obuća, Mina; Cvačková, Zuzana; Kubovčiak, Jan; Kolář, Michal; Staněk, David. Retinitis pigmentosa-linked mutation in DHX38 modulates its splicing activity. Plos One. 17(4):e0265742. PubMed |