Anti SNCAIP pAb (ATL-HPA064687)

Atlas Antibodies

SKU:
ATL-HPA064687-25
  • Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
  • Immunofluorescent staining of human cell line RT4 shows localization to cytoplasmic bodies.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: synuclein, alpha interacting protein
Gene Name: SNCAIP
Alternative Gene Name: SYPH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024534: 68%, ENSRNOG00000018254: 64%
Entrez Gene ID: 9627
Uniprot ID: Q9Y6H5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RKASAVIHDQHKLSTEETEISPPLVKCGSAYEPENQSKDFLNKTFSDPHGRKVEKTTPDCQLRAFHLQSSAAESKPEEQVSGLNRTSSQGPEERSEYLK
Gene Sequence RKASAVIHDQHKLSTEETEISPPLVKCGSAYEPENQSKDFLNKTFSDPHGRKVEKTTPDCQLRAFHLQSSAAESKPEEQVSGLNRTSSQGPEERSEYLK
Gene ID - Mouse ENSMUSG00000024534
Gene ID - Rat ENSRNOG00000018254
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SNCAIP pAb (ATL-HPA064687)
Datasheet Anti SNCAIP pAb (ATL-HPA064687) Datasheet (External Link)
Vendor Page Anti SNCAIP pAb (ATL-HPA064687) at Atlas Antibodies

Documents & Links for Anti SNCAIP pAb (ATL-HPA064687)
Datasheet Anti SNCAIP pAb (ATL-HPA064687) Datasheet (External Link)
Vendor Page Anti SNCAIP pAb (ATL-HPA064687)