Anti SNAPC3 pAb (ATL-HPA066031)

Atlas Antibodies

SKU:
ATL-HPA066031-25
  • Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm.
  • Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: small nuclear RNA activating complex, polypeptide 3, 50kDa
Gene Name: SNAPC3
Alternative Gene Name: MGC132011, MGC33124, PTFbeta, SNAP50
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028483: 74%, ENSRNOG00000010825: 75%
Entrez Gene ID: 6619
Uniprot ID: Q92966
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LPELNTRAFHVGAFGELWRGRLRGAGDLSLREPPASALPGSQAADSDREDAAVARDLDCSLEAAAELRAVCGLDKLKCLEDGEDPEVIPENTDLVT
Gene Sequence LPELNTRAFHVGAFGELWRGRLRGAGDLSLREPPASALPGSQAADSDREDAAVARDLDCSLEAAAELRAVCGLDKLKCLEDGEDPEVIPENTDLVT
Gene ID - Mouse ENSMUSG00000028483
Gene ID - Rat ENSRNOG00000010825
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SNAPC3 pAb (ATL-HPA066031)
Datasheet Anti SNAPC3 pAb (ATL-HPA066031) Datasheet (External Link)
Vendor Page Anti SNAPC3 pAb (ATL-HPA066031) at Atlas Antibodies

Documents & Links for Anti SNAPC3 pAb (ATL-HPA066031)
Datasheet Anti SNAPC3 pAb (ATL-HPA066031) Datasheet (External Link)
Vendor Page Anti SNAPC3 pAb (ATL-HPA066031)