Anti SNAPC1 pAb (ATL-HPA072276)

Atlas Antibodies

SKU:
ATL-HPA072276-25
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nucleoli.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: small nuclear RNA activating complex polypeptide 1
Gene Name: SNAPC1
Alternative Gene Name: PTFgamma, SNAP43
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021113: 87%, ENSRNOG00000009296: 84%
Entrez Gene ID: 6617
Uniprot ID: Q16533
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TPPGLQTDCEALLSRFQETDSVRFEDFTELWRNMKFGTIFCGRMRNLEKNMFTKEALALAWR
Gene Sequence TPPGLQTDCEALLSRFQETDSVRFEDFTELWRNMKFGTIFCGRMRNLEKNMFTKEALALAWR
Gene ID - Mouse ENSMUSG00000021113
Gene ID - Rat ENSRNOG00000009296
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SNAPC1 pAb (ATL-HPA072276)
Datasheet Anti SNAPC1 pAb (ATL-HPA072276) Datasheet (External Link)
Vendor Page Anti SNAPC1 pAb (ATL-HPA072276) at Atlas Antibodies

Documents & Links for Anti SNAPC1 pAb (ATL-HPA072276)
Datasheet Anti SNAPC1 pAb (ATL-HPA072276) Datasheet (External Link)
Vendor Page Anti SNAPC1 pAb (ATL-HPA072276)