Anti SNAP29 pAb (ATL-HPA056492)

Atlas Antibodies

Catalog No.:
ATL-HPA056492-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: synaptosomal-associated protein, 29kDa
Gene Name: SNAP29
Alternative Gene Name: CEDNIK, SNAP-29
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022765: 86%, ENSRNOG00000001867: 84%
Entrez Gene ID: 9342
Uniprot ID: O95721
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTSQPNNRLKE
Gene Sequence VASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTSQPNNRLKE
Gene ID - Mouse ENSMUSG00000022765
Gene ID - Rat ENSRNOG00000001867
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SNAP29 pAb (ATL-HPA056492)
Datasheet Anti SNAP29 pAb (ATL-HPA056492) Datasheet (External Link)
Vendor Page Anti SNAP29 pAb (ATL-HPA056492) at Atlas Antibodies

Documents & Links for Anti SNAP29 pAb (ATL-HPA056492)
Datasheet Anti SNAP29 pAb (ATL-HPA056492) Datasheet (External Link)
Vendor Page Anti SNAP29 pAb (ATL-HPA056492)