Anti SNAI3 pAb (ATL-HPA071127)

Atlas Antibodies

SKU: ATL-HPA071127-25

• 

Protein Description: snail family zinc finger 3
Gene Name: SNAI3
Alternative Gene Name: SMUC, Zfp293, ZNF293
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006587: 64%, ENSRNOG00000013586: 64%
Entrez Gene ID: 333929
Uniprot ID: Q3KNW1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: THSSHRVPNYRRLETQREINGACSACGGLVVPLLPRDKEAPSVPGDVPQPWDRSSAVACISLPLLPRIEEAL
• Gene Sequence: THSSHRVPNYRRLETQREINGACSACGGLVVPLLPRDKEAPSVPGDVPQPWDRSSAVACISLPLLPRIEEAL
• Gene ID - Mouse: ENSMUSG00000006587
• Gene ID - Rat: ENSRNOG00000013586
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.