Anti SNAI1 pAb (ATL-HPA056831)

Atlas Antibodies

Catalog No.:
ATL-HPA056831-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: snail family transcriptional repressor 1
Gene Name: SNAI1
Alternative Gene Name: SLUGH2, SNA, SNAH, SNAIL, SNAIL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042821: 82%, ENSRNOG00000009594: 84%
Entrez Gene ID: 6615
Uniprot ID: O95863
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SVSSLEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLG
Gene Sequence SVSSLEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLG
Gene ID - Mouse ENSMUSG00000042821
Gene ID - Rat ENSRNOG00000009594
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SNAI1 pAb (ATL-HPA056831)
Datasheet Anti SNAI1 pAb (ATL-HPA056831) Datasheet (External Link)
Vendor Page Anti SNAI1 pAb (ATL-HPA056831) at Atlas Antibodies

Documents & Links for Anti SNAI1 pAb (ATL-HPA056831)
Datasheet Anti SNAI1 pAb (ATL-HPA056831) Datasheet (External Link)
Vendor Page Anti SNAI1 pAb (ATL-HPA056831)