Anti SNAI1 pAb (ATL-HPA056831)

Atlas Antibodies

SKU: ATL-HPA056831-25

• 

Protein Description: snail family transcriptional repressor 1
Gene Name: SNAI1
Alternative Gene Name: SLUGH2, SNA, SNAH, SNAIL, SNAIL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042821: 82%, ENSRNOG00000009594: 84%
Entrez Gene ID: 6615
Uniprot ID: O95863
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SVSSLEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLG
• Gene Sequence: SVSSLEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLG
• Gene ID - Mouse: ENSMUSG00000042821
• Gene ID - Rat: ENSRNOG00000009594
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.