Anti SMYD1 pAb (ATL-HPA062282 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA062282-100
  • Immunohistochemistry analysis in human skeletal muscle and prostate tissues using Anti-SMYD1 antibody. Corresponding SMYD1 RNA-seq data are presented for the same tissues.
  • Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human Skeletal muscle tissue
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: SET and MYND domain containing 1
Gene Name: SMYD1
Alternative Gene Name: BOP, KMT3D, ZMYND22
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055027: 99%, ENSRNOG00000006776: 99%
Entrez Gene ID: 150572
Uniprot ID: Q8NB12
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NIRLAARIMWRVEREGTGLTEGCLVSVDDLQNHVEHFGEEEQKDLRVDVDTFLQYWPPQSQQFSMQYISHIF
Gene Sequence NIRLAARIMWRVEREGTGLTEGCLVSVDDLQNHVEHFGEEEQKDLRVDVDTFLQYWPPQSQQFSMQYISHIF
Gene ID - Mouse ENSMUSG00000055027
Gene ID - Rat ENSRNOG00000006776
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SMYD1 pAb (ATL-HPA062282 w/enhanced validation)
Datasheet Anti SMYD1 pAb (ATL-HPA062282 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SMYD1 pAb (ATL-HPA062282 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti SMYD1 pAb (ATL-HPA062282 w/enhanced validation)
Datasheet Anti SMYD1 pAb (ATL-HPA062282 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SMYD1 pAb (ATL-HPA062282 w/enhanced validation)