Anti SMUG1 pAb (ATL-HPA026804)

Atlas Antibodies

Catalog No.:
ATL-HPA026804-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: single-strand-selective monofunctional uracil-DNA glycosylase 1
Gene Name: SMUG1
Alternative Gene Name: FDG, HMUDG, UNG3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036061: 92%, ENSRNOG00000036842: 90%
Entrez Gene ID: 23583
Uniprot ID: Q53HV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QPEVFFHHCFVHNLCPLLFLAPSGRNLTPAELPAKQREQLLGICDAALCRQVQLLGVRLVVGVGRLAEQRARRALAGLMPEVQVEGLLHPSPRNPQANKGWEAVAKERLNELGLL
Gene Sequence QPEVFFHHCFVHNLCPLLFLAPSGRNLTPAELPAKQREQLLGICDAALCRQVQLLGVRLVVGVGRLAEQRARRALAGLMPEVQVEGLLHPSPRNPQANKGWEAVAKERLNELGLL
Gene ID - Mouse ENSMUSG00000036061
Gene ID - Rat ENSRNOG00000036842
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SMUG1 pAb (ATL-HPA026804)
Datasheet Anti SMUG1 pAb (ATL-HPA026804) Datasheet (External Link)
Vendor Page Anti SMUG1 pAb (ATL-HPA026804) at Atlas Antibodies

Documents & Links for Anti SMUG1 pAb (ATL-HPA026804)
Datasheet Anti SMUG1 pAb (ATL-HPA026804) Datasheet (External Link)
Vendor Page Anti SMUG1 pAb (ATL-HPA026804)