Anti SMTN pAb (ATL-HPA058590 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA058590-25
  • Immunohistochemical staining of human rectum shows moderate to strong cytoplasmic positivity in smooth muscle cells.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: smoothelin
Gene Name: SMTN
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020439: 86%, ENSRNOG00000019451: 86%
Entrez Gene ID: 6525
Uniprot ID: P53814
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PVARSEEPGAPLPVAVGTAEPGGSMKTTFTIEIKDGRGQASTGRVLLPTGNQRAELTLGLRAPPTLLSTSSGGKSTITRVNSPGT
Gene Sequence PVARSEEPGAPLPVAVGTAEPGGSMKTTFTIEIKDGRGQASTGRVLLPTGNQRAELTLGLRAPPTLLSTSSGGKSTITRVNSPGT
Gene ID - Mouse ENSMUSG00000020439
Gene ID - Rat ENSRNOG00000019451
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SMTN pAb (ATL-HPA058590 w/enhanced validation)
Datasheet Anti SMTN pAb (ATL-HPA058590 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SMTN pAb (ATL-HPA058590 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti SMTN pAb (ATL-HPA058590 w/enhanced validation)
Datasheet Anti SMTN pAb (ATL-HPA058590 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SMTN pAb (ATL-HPA058590 w/enhanced validation)