Anti SMPX pAb (ATL-HPA077360)

Atlas Antibodies

Catalog No.:
ATL-HPA077360-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: small muscle protein, X-linked
Gene Name: SMPX
Alternative Gene Name: DFN6, DFNX4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041476: 85%, ENSRNOG00000007495: 79%
Entrez Gene ID: 23676
Uniprot ID: Q9UHP9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ANINIPMGAFRPGAGQPPRRKECTPEVEEGVPPTSDEEKKPIPGAKKLPGPAVNLSEIQNIK
Gene Sequence ANINIPMGAFRPGAGQPPRRKECTPEVEEGVPPTSDEEKKPIPGAKKLPGPAVNLSEIQNIK
Gene ID - Mouse ENSMUSG00000041476
Gene ID - Rat ENSRNOG00000007495
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SMPX pAb (ATL-HPA077360)
Datasheet Anti SMPX pAb (ATL-HPA077360) Datasheet (External Link)
Vendor Page Anti SMPX pAb (ATL-HPA077360) at Atlas Antibodies

Documents & Links for Anti SMPX pAb (ATL-HPA077360)
Datasheet Anti SMPX pAb (ATL-HPA077360) Datasheet (External Link)
Vendor Page Anti SMPX pAb (ATL-HPA077360)