Anti SMPX pAb (ATL-HPA077360)

Atlas Antibodies

Catalog No.: ATL-HPA077360-25

Protein Description: small muscle protein, X-linked
Gene Name: SMPX
Alternative Gene Name: DFN6, DFNX4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041476: 85%, ENSRNOG00000007495: 79%
Entrez Gene ID: 23676
Uniprot ID: Q9UHP9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ANINIPMGAFRPGAGQPPRRKECTPEVEEGVPPTSDEEKKPIPGAKKLPGPAVNLSEIQNIK
• Gene Sequence: ANINIPMGAFRPGAGQPPRRKECTPEVEEGVPPTSDEEKKPIPGAKKLPGPAVNLSEIQNIK
• Gene ID - Mouse: ENSMUSG00000041476
• Gene ID - Rat: ENSRNOG00000007495
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.