Anti SMPD4 pAb (ATL-HPA049426)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049426-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: SMPD4
Alternative Gene Name: FLJ20297, FLJ20756, KIAA1418, NET13, nSMase-3, NSMASE3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005899: 81%, ENSRNOG00000001875: 84%
Entrez Gene ID: 55627
Uniprot ID: Q9NXE4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LAQLITQAKHTAKSISDQCAESPAGHSFLSWLGFSSMDTNGSYTANDLDEMGQDSVRKTDEYLEKALEYLRQIFRLSEAQLRQFTLALGTTQDENGKKQLPDCI |
Gene Sequence | LAQLITQAKHTAKSISDQCAESPAGHSFLSWLGFSSMDTNGSYTANDLDEMGQDSVRKTDEYLEKALEYLRQIFRLSEAQLRQFTLALGTTQDENGKKQLPDCI |
Gene ID - Mouse | ENSMUSG00000005899 |
Gene ID - Rat | ENSRNOG00000001875 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SMPD4 pAb (ATL-HPA049426) | |
Datasheet | Anti SMPD4 pAb (ATL-HPA049426) Datasheet (External Link) |
Vendor Page | Anti SMPD4 pAb (ATL-HPA049426) at Atlas Antibodies |
Documents & Links for Anti SMPD4 pAb (ATL-HPA049426) | |
Datasheet | Anti SMPD4 pAb (ATL-HPA049426) Datasheet (External Link) |
Vendor Page | Anti SMPD4 pAb (ATL-HPA049426) |
Citations for Anti SMPD4 pAb (ATL-HPA049426) – 1 Found |
Cheng, Li-Chun; Baboo, Sabyasachi; Lindsay, Cory; Brusman, Liza; Martinez-Bartolomé, Salvador; Tapia, Olga; Zhang, Xi; Yates, John R 3rd; Gerace, Larry. Identification of new transmembrane proteins concentrated at the nuclear envelope using organellar proteomics of mesenchymal cells. Nucleus (Austin, Tex.). 2019;10(1):126-143. PubMed |