Anti SMOX pAb (ATL-HPA047117)

Atlas Antibodies

Catalog No.:
ATL-HPA047117-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: spermine oxidase
Gene Name: SMOX
Alternative Gene Name: C20orf16, dJ779E11.1, FLJ20746, MGC1010, PAO, PAOh1, SMO
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027333: 94%, ENSRNOG00000021255: 98%
Entrez Gene ID: 54498
Uniprot ID: Q9NWM0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QGFTDVTVLEASSHIGGRVQSVKLGHATFELGATWIHGSHGNPIYHLAEANGLLEETTDGERSVGRISLYSKNGVACYLTNHGRRIPKDVVEEFSDLYN
Gene Sequence QGFTDVTVLEASSHIGGRVQSVKLGHATFELGATWIHGSHGNPIYHLAEANGLLEETTDGERSVGRISLYSKNGVACYLTNHGRRIPKDVVEEFSDLYN
Gene ID - Mouse ENSMUSG00000027333
Gene ID - Rat ENSRNOG00000021255
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SMOX pAb (ATL-HPA047117)
Datasheet Anti SMOX pAb (ATL-HPA047117) Datasheet (External Link)
Vendor Page Anti SMOX pAb (ATL-HPA047117) at Atlas Antibodies

Documents & Links for Anti SMOX pAb (ATL-HPA047117)
Datasheet Anti SMOX pAb (ATL-HPA047117) Datasheet (External Link)
Vendor Page Anti SMOX pAb (ATL-HPA047117)
Citations for Anti SMOX pAb (ATL-HPA047117) – 1 Found
Tepper, Armand W J W; Chu, Gerald; Klaren, Vincent N A; Kalin, Jay H; Molina-Ortiz, Patricia; Impagliazzo, Antonietta. Development and characterization of rabbit monoclonal antibodies that recognize human spermine oxidase and application to immunohistochemistry of human cancer tissues. Plos One. 17(4):e0267046.  PubMed