Anti SMLR1 pAb (ATL-HPA066060)

Atlas Antibodies

Catalog No.:
ATL-HPA066060-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: small leucine-rich protein 1
Gene Name: SMLR1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096546: 56%, ENSRNOG00000047821: 47%
Entrez Gene ID: 100507203
Uniprot ID: H3BR10
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FRIKLIEVNEELSQNCDRQHNPKDGSSLYQRMKW
Gene Sequence FRIKLIEVNEELSQNCDRQHNPKDGSSLYQRMKW
Gene ID - Mouse ENSMUSG00000096546
Gene ID - Rat ENSRNOG00000047821
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SMLR1 pAb (ATL-HPA066060)
Datasheet Anti SMLR1 pAb (ATL-HPA066060) Datasheet (External Link)
Vendor Page Anti SMLR1 pAb (ATL-HPA066060) at Atlas Antibodies

Documents & Links for Anti SMLR1 pAb (ATL-HPA066060)
Datasheet Anti SMLR1 pAb (ATL-HPA066060) Datasheet (External Link)
Vendor Page Anti SMLR1 pAb (ATL-HPA066060)