Anti SMLR1 pAb (ATL-HPA066060)
Atlas Antibodies
- SKU:
- ATL-HPA066060-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: SMLR1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096546: 56%, ENSRNOG00000047821: 47%
Entrez Gene ID: 100507203
Uniprot ID: H3BR10
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FRIKLIEVNEELSQNCDRQHNPKDGSSLYQRMKW |
Gene Sequence | FRIKLIEVNEELSQNCDRQHNPKDGSSLYQRMKW |
Gene ID - Mouse | ENSMUSG00000096546 |
Gene ID - Rat | ENSRNOG00000047821 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SMLR1 pAb (ATL-HPA066060) | |
Datasheet | Anti SMLR1 pAb (ATL-HPA066060) Datasheet (External Link) |
Vendor Page | Anti SMLR1 pAb (ATL-HPA066060) at Atlas Antibodies |
Documents & Links for Anti SMLR1 pAb (ATL-HPA066060) | |
Datasheet | Anti SMLR1 pAb (ATL-HPA066060) Datasheet (External Link) |
Vendor Page | Anti SMLR1 pAb (ATL-HPA066060) |