Anti SMLR1 pAb (ATL-HPA066060)
Atlas Antibodies
- Catalog No.:
- ATL-HPA066060-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: SMLR1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096546: 56%, ENSRNOG00000047821: 47%
Entrez Gene ID: 100507203
Uniprot ID: H3BR10
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FRIKLIEVNEELSQNCDRQHNPKDGSSLYQRMKW |
| Gene Sequence | FRIKLIEVNEELSQNCDRQHNPKDGSSLYQRMKW |
| Gene ID - Mouse | ENSMUSG00000096546 |
| Gene ID - Rat | ENSRNOG00000047821 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SMLR1 pAb (ATL-HPA066060) | |
| Datasheet | Anti SMLR1 pAb (ATL-HPA066060) Datasheet (External Link) |
| Vendor Page | Anti SMLR1 pAb (ATL-HPA066060) at Atlas Antibodies |
| Documents & Links for Anti SMLR1 pAb (ATL-HPA066060) | |
| Datasheet | Anti SMLR1 pAb (ATL-HPA066060) Datasheet (External Link) |
| Vendor Page | Anti SMLR1 pAb (ATL-HPA066060) |