Anti SMKR1 pAb (ATL-HPA078358)
Atlas Antibodies
- Catalog No.:
- ATL-HPA078358-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: SMKR1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051375: 30%, ENSRNOG00000060410: 30%
Entrez Gene ID: 100287482
Uniprot ID: H3BMG3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MPAKGKKGKGQGKSHGKKQKKPEVDILSPAAMLNLYYIAHNVADCLHLRGFHWPGAPKGKKGRSK |
| Gene Sequence | MPAKGKKGKGQGKSHGKKQKKPEVDILSPAAMLNLYYIAHNVADCLHLRGFHWPGAPKGKKGRSK |
| Gene ID - Mouse | ENSMUSG00000051375 |
| Gene ID - Rat | ENSRNOG00000060410 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SMKR1 pAb (ATL-HPA078358) | |
| Datasheet | Anti SMKR1 pAb (ATL-HPA078358) Datasheet (External Link) |
| Vendor Page | Anti SMKR1 pAb (ATL-HPA078358) at Atlas Antibodies |
| Documents & Links for Anti SMKR1 pAb (ATL-HPA078358) | |
| Datasheet | Anti SMKR1 pAb (ATL-HPA078358) Datasheet (External Link) |
| Vendor Page | Anti SMKR1 pAb (ATL-HPA078358) |