Anti SMIM9 pAb (ATL-HPA060970)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060970-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: SMIM9
Alternative Gene Name: CXorf68
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054889: 33%, ENSRNOG00000013928: 33%
Entrez Gene ID: 100132963
Uniprot ID: A6NGZ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SSPLPLSALGIQEKTGSKPRSGGNHRSWLNNFRDYLWQLIKSALPP |
Gene Sequence | SSPLPLSALGIQEKTGSKPRSGGNHRSWLNNFRDYLWQLIKSALPP |
Gene ID - Mouse | ENSMUSG00000054889 |
Gene ID - Rat | ENSRNOG00000013928 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SMIM9 pAb (ATL-HPA060970) | |
Datasheet | Anti SMIM9 pAb (ATL-HPA060970) Datasheet (External Link) |
Vendor Page | Anti SMIM9 pAb (ATL-HPA060970) at Atlas Antibodies |
Documents & Links for Anti SMIM9 pAb (ATL-HPA060970) | |
Datasheet | Anti SMIM9 pAb (ATL-HPA060970) Datasheet (External Link) |
Vendor Page | Anti SMIM9 pAb (ATL-HPA060970) |