Anti SMIM9 pAb (ATL-HPA060970)

Atlas Antibodies

Catalog No.:
ATL-HPA060970-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: small integral membrane protein 9
Gene Name: SMIM9
Alternative Gene Name: CXorf68
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054889: 33%, ENSRNOG00000013928: 33%
Entrez Gene ID: 100132963
Uniprot ID: A6NGZ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSPLPLSALGIQEKTGSKPRSGGNHRSWLNNFRDYLWQLIKSALPP
Gene Sequence SSPLPLSALGIQEKTGSKPRSGGNHRSWLNNFRDYLWQLIKSALPP
Gene ID - Mouse ENSMUSG00000054889
Gene ID - Rat ENSRNOG00000013928
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SMIM9 pAb (ATL-HPA060970)
Datasheet Anti SMIM9 pAb (ATL-HPA060970) Datasheet (External Link)
Vendor Page Anti SMIM9 pAb (ATL-HPA060970) at Atlas Antibodies

Documents & Links for Anti SMIM9 pAb (ATL-HPA060970)
Datasheet Anti SMIM9 pAb (ATL-HPA060970) Datasheet (External Link)
Vendor Page Anti SMIM9 pAb (ATL-HPA060970)