Anti SMIM9 pAb (ATL-HPA060970)

Atlas Antibodies

Catalog No.: ATL-HPA060970-25

Protein Description: small integral membrane protein 9
Gene Name: SMIM9
Alternative Gene Name: CXorf68
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054889: 33%, ENSRNOG00000013928: 33%
Entrez Gene ID: 100132963
Uniprot ID: A6NGZ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSPLPLSALGIQEKTGSKPRSGGNHRSWLNNFRDYLWQLIKSALPP
• Gene Sequence: SSPLPLSALGIQEKTGSKPRSGGNHRSWLNNFRDYLWQLIKSALPP
• Gene ID - Mouse: ENSMUSG00000054889
• Gene ID - Rat: ENSRNOG00000013928
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.