Anti SMIM8 pAb (ATL-HPA007401)
Atlas Antibodies
- Catalog No.:
- ATL-HPA007401-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: SMIM8
Alternative Gene Name: C6orf162, dJ102H19.2, DKFZP586E1923
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028295: 83%, ENSRNOG00000023035: 79%
Entrez Gene ID: 57150
Uniprot ID: Q96KF7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MSSAPEPPTFKKEPPKEKEFQSPGLRGVRTTTLFRAVNPELFIKPNKP |
| Gene Sequence | MSSAPEPPTFKKEPPKEKEFQSPGLRGVRTTTLFRAVNPELFIKPNKP |
| Gene ID - Mouse | ENSMUSG00000028295 |
| Gene ID - Rat | ENSRNOG00000023035 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SMIM8 pAb (ATL-HPA007401) | |
| Datasheet | Anti SMIM8 pAb (ATL-HPA007401) Datasheet (External Link) |
| Vendor Page | Anti SMIM8 pAb (ATL-HPA007401) at Atlas Antibodies |
| Documents & Links for Anti SMIM8 pAb (ATL-HPA007401) | |
| Datasheet | Anti SMIM8 pAb (ATL-HPA007401) Datasheet (External Link) |
| Vendor Page | Anti SMIM8 pAb (ATL-HPA007401) |