Anti SMIM8 pAb (ATL-HPA007401)

Atlas Antibodies

Catalog No.:
ATL-HPA007401-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: small integral membrane protein 8
Gene Name: SMIM8
Alternative Gene Name: C6orf162, dJ102H19.2, DKFZP586E1923
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028295: 83%, ENSRNOG00000023035: 79%
Entrez Gene ID: 57150
Uniprot ID: Q96KF7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSSAPEPPTFKKEPPKEKEFQSPGLRGVRTTTLFRAVNPELFIKPNKP
Gene Sequence MSSAPEPPTFKKEPPKEKEFQSPGLRGVRTTTLFRAVNPELFIKPNKP
Gene ID - Mouse ENSMUSG00000028295
Gene ID - Rat ENSRNOG00000023035
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SMIM8 pAb (ATL-HPA007401)
Datasheet Anti SMIM8 pAb (ATL-HPA007401) Datasheet (External Link)
Vendor Page Anti SMIM8 pAb (ATL-HPA007401) at Atlas Antibodies

Documents & Links for Anti SMIM8 pAb (ATL-HPA007401)
Datasheet Anti SMIM8 pAb (ATL-HPA007401) Datasheet (External Link)
Vendor Page Anti SMIM8 pAb (ATL-HPA007401)