Anti SMIM5 pAb (ATL-HPA065332)
Atlas Antibodies
- Catalog No.:
- ATL-HPA065332-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: SMIM5
Alternative Gene Name: C17orf109
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048442: 84%, ENSRNOG00000049642: 78%
Entrez Gene ID: 643008
Uniprot ID: Q71RC9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MAATDFVQEMRAVGERLLLKLQRLPQAEPVEI |
| Gene Sequence | MAATDFVQEMRAVGERLLLKLQRLPQAEPVEI |
| Gene ID - Mouse | ENSMUSG00000048442 |
| Gene ID - Rat | ENSRNOG00000049642 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SMIM5 pAb (ATL-HPA065332) | |
| Datasheet | Anti SMIM5 pAb (ATL-HPA065332) Datasheet (External Link) |
| Vendor Page | Anti SMIM5 pAb (ATL-HPA065332) at Atlas Antibodies |
| Documents & Links for Anti SMIM5 pAb (ATL-HPA065332) | |
| Datasheet | Anti SMIM5 pAb (ATL-HPA065332) Datasheet (External Link) |
| Vendor Page | Anti SMIM5 pAb (ATL-HPA065332) |