Anti SMIM5 pAb (ATL-HPA065332)

Atlas Antibodies

Catalog No.: ATL-HPA065332-25

Protein Description: small integral membrane protein 5
Gene Name: SMIM5
Alternative Gene Name: C17orf109
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048442: 84%, ENSRNOG00000049642: 78%
Entrez Gene ID: 643008
Uniprot ID: Q71RC9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAATDFVQEMRAVGERLLLKLQRLPQAEPVEI
• Gene Sequence: MAATDFVQEMRAVGERLLLKLQRLPQAEPVEI
• Gene ID - Mouse: ENSMUSG00000048442
• Gene ID - Rat: ENSRNOG00000049642
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.