Anti SMIM22 pAb (ATL-HPA077331)

Atlas Antibodies

Catalog No.:
ATL-HPA077331-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: small integral membrane protein 22
Gene Name: SMIM22
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096215: 57%, ENSRNOG00000042344: 53%
Entrez Gene ID: 440335
Uniprot ID: K7EJ46
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VSTEELEATVQEVLGRLKSHQFFQSTWDTV
Gene Sequence VSTEELEATVQEVLGRLKSHQFFQSTWDTV
Gene ID - Mouse ENSMUSG00000096215
Gene ID - Rat ENSRNOG00000042344
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SMIM22 pAb (ATL-HPA077331)
Datasheet Anti SMIM22 pAb (ATL-HPA077331) Datasheet (External Link)
Vendor Page Anti SMIM22 pAb (ATL-HPA077331) at Atlas Antibodies

Documents & Links for Anti SMIM22 pAb (ATL-HPA077331)
Datasheet Anti SMIM22 pAb (ATL-HPA077331) Datasheet (External Link)
Vendor Page Anti SMIM22 pAb (ATL-HPA077331)