Anti SMIM17 pAb (ATL-HPA071861 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA071861-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: small integral membrane protein 17
Gene Name: SMIM17
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000093536: 66%, ENSRNOG00000042502: 64%
Entrez Gene ID: 147670
Uniprot ID: P0DL12
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MQSLRPEQTRGLLEPERTKTLLPRESRAWEKPPHPACTKDWEAVEVGASS
Gene Sequence MQSLRPEQTRGLLEPERTKTLLPRESRAWEKPPHPACTKDWEAVEVGASS
Gene ID - Mouse ENSMUSG00000093536
Gene ID - Rat ENSRNOG00000042502
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SMIM17 pAb (ATL-HPA071861 w/enhanced validation)
Datasheet Anti SMIM17 pAb (ATL-HPA071861 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SMIM17 pAb (ATL-HPA071861 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti SMIM17 pAb (ATL-HPA071861 w/enhanced validation)
Datasheet Anti SMIM17 pAb (ATL-HPA071861 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SMIM17 pAb (ATL-HPA071861 w/enhanced validation)