Anti SMIM17 pAb (ATL-HPA071857)
Atlas Antibodies
- Catalog No.:
- ATL-HPA071857-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: SMIM17
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000093536: 96%, ENSRNOG00000042502: 94%
Entrez Gene ID: 147670
Uniprot ID: P0DL12
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SHDSDEKDLSSQETGLSQEWSSVEEDDESEGSQGFVEWSKAPQQTTIVLV |
| Gene Sequence | SHDSDEKDLSSQETGLSQEWSSVEEDDESEGSQGFVEWSKAPQQTTIVLV |
| Gene ID - Mouse | ENSMUSG00000093536 |
| Gene ID - Rat | ENSRNOG00000042502 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SMIM17 pAb (ATL-HPA071857) | |
| Datasheet | Anti SMIM17 pAb (ATL-HPA071857) Datasheet (External Link) |
| Vendor Page | Anti SMIM17 pAb (ATL-HPA071857) at Atlas Antibodies |
| Documents & Links for Anti SMIM17 pAb (ATL-HPA071857) | |
| Datasheet | Anti SMIM17 pAb (ATL-HPA071857) Datasheet (External Link) |
| Vendor Page | Anti SMIM17 pAb (ATL-HPA071857) |