Anti SMIM13 pAb (ATL-HPA065706 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA065706-25

Protein Description: small integral membrane protein 13
Gene Name: SMIM13
Alternative Gene Name: C6orf228
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091264: 79%, ENSRNOG00000043288: 77%
Entrez Gene ID: 221710
Uniprot ID: P0DJ93
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WHLFLSKFKFLRELVGDTGSQEGDHEPSGSETEEDTSSSPHRIRSARQRRAPADEGHRPLT
• Gene Sequence: WHLFLSKFKFLRELVGDTGSQEGDHEPSGSETEEDTSSSPHRIRSARQRRAPADEGHRPLT
• Gene ID - Mouse: ENSMUSG00000091264
• Gene ID - Rat: ENSRNOG00000043288
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.