Anti SMIM13 pAb (ATL-HPA065706 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA065706-25
  • Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-SMIM13 antibody. Corresponding SMIM13 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus, nuclear membrane & the Golgi apparatus.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: small integral membrane protein 13
Gene Name: SMIM13
Alternative Gene Name: C6orf228
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091264: 79%, ENSRNOG00000043288: 77%
Entrez Gene ID: 221710
Uniprot ID: P0DJ93
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WHLFLSKFKFLRELVGDTGSQEGDHEPSGSETEEDTSSSPHRIRSARQRRAPADEGHRPLT
Gene Sequence WHLFLSKFKFLRELVGDTGSQEGDHEPSGSETEEDTSSSPHRIRSARQRRAPADEGHRPLT
Gene ID - Mouse ENSMUSG00000091264
Gene ID - Rat ENSRNOG00000043288
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti SMIM13 pAb (ATL-HPA065706 w/enhanced validation)
Datasheet Anti SMIM13 pAb (ATL-HPA065706 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SMIM13 pAb (ATL-HPA065706 w/enhanced validation)