Anti SMG1 pAb (ATL-HPA073972)

Atlas Antibodies

Catalog No.:
ATL-HPA073972-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: SMG1 phosphatidylinositol 3-kinase-related kinase
Gene Name: SMG1
Alternative Gene Name: ATX, KIAA0421, LIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030655: 98%, ENSRNOG00000012274: 25%
Entrez Gene ID: 23049
Uniprot ID: Q96Q15
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QLFSRLNHPEVYVRQSICNLLCRVAQDSPHLILYPAIVGTISLSSESQASGNKFSTAIPTLLGNIQGEELLVSECEGGSPPASQDSNKDEPKS
Gene Sequence QLFSRLNHPEVYVRQSICNLLCRVAQDSPHLILYPAIVGTISLSSESQASGNKFSTAIPTLLGNIQGEELLVSECEGGSPPASQDSNKDEPKS
Gene ID - Mouse ENSMUSG00000030655
Gene ID - Rat ENSRNOG00000012274
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SMG1 pAb (ATL-HPA073972)
Datasheet Anti SMG1 pAb (ATL-HPA073972) Datasheet (External Link)
Vendor Page Anti SMG1 pAb (ATL-HPA073972) at Atlas Antibodies

Documents & Links for Anti SMG1 pAb (ATL-HPA073972)
Datasheet Anti SMG1 pAb (ATL-HPA073972) Datasheet (External Link)
Vendor Page Anti SMG1 pAb (ATL-HPA073972)