Anti SMCO1 pAb (ATL-HPA061937)

Atlas Antibodies

Catalog No.:
ATL-HPA061937-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: single-pass membrane protein with coiled-coil domains 1
Gene Name: SMCO1
Alternative Gene Name: C3orf43, DKFZp313B0440, FLJ41923
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046345: 81%, ENSRNOG00000048188: 83%
Entrez Gene ID: 255798
Uniprot ID: Q147U7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MNNETTTLISLKEAMKRVDHKLQALETQFKELDFTKDNLMQKFEHHSKALASQ
Gene Sequence MNNETTTLISLKEAMKRVDHKLQALETQFKELDFTKDNLMQKFEHHSKALASQ
Gene ID - Mouse ENSMUSG00000046345
Gene ID - Rat ENSRNOG00000048188
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SMCO1 pAb (ATL-HPA061937)
Datasheet Anti SMCO1 pAb (ATL-HPA061937) Datasheet (External Link)
Vendor Page Anti SMCO1 pAb (ATL-HPA061937) at Atlas Antibodies

Documents & Links for Anti SMCO1 pAb (ATL-HPA061937)
Datasheet Anti SMCO1 pAb (ATL-HPA061937) Datasheet (External Link)
Vendor Page Anti SMCO1 pAb (ATL-HPA061937)