Anti SMCO1 pAb (ATL-HPA061937)

Atlas Antibodies

Catalog No.: ATL-HPA061937-25

Protein Description: single-pass membrane protein with coiled-coil domains 1
Gene Name: SMCO1
Alternative Gene Name: C3orf43, DKFZp313B0440, FLJ41923
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046345: 81%, ENSRNOG00000048188: 83%
Entrez Gene ID: 255798
Uniprot ID: Q147U7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MNNETTTLISLKEAMKRVDHKLQALETQFKELDFTKDNLMQKFEHHSKALASQ
• Gene Sequence: MNNETTTLISLKEAMKRVDHKLQALETQFKELDFTKDNLMQKFEHHSKALASQ
• Gene ID - Mouse: ENSMUSG00000046345
• Gene ID - Rat: ENSRNOG00000048188
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.