Anti SMARCD2 pAb (ATL-HPA059934)

Atlas Antibodies

Catalog No.:
ATL-HPA059934-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2
Gene Name: SMARCD2
Alternative Gene Name: BAF60B, CRACD2, PRO2451, Rsc6p
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078619: 92%, ENSRNOG00000010557: 90%
Entrez Gene ID: 6603
Uniprot ID: Q92925
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RIYISNTFSPSKAEGDSAGTAGTPGGTPAGDKVASWELR
Gene Sequence RIYISNTFSPSKAEGDSAGTAGTPGGTPAGDKVASWELR
Gene ID - Mouse ENSMUSG00000078619
Gene ID - Rat ENSRNOG00000010557
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SMARCD2 pAb (ATL-HPA059934)
Datasheet Anti SMARCD2 pAb (ATL-HPA059934) Datasheet (External Link)
Vendor Page Anti SMARCD2 pAb (ATL-HPA059934) at Atlas Antibodies

Documents & Links for Anti SMARCD2 pAb (ATL-HPA059934)
Datasheet Anti SMARCD2 pAb (ATL-HPA059934) Datasheet (External Link)
Vendor Page Anti SMARCD2 pAb (ATL-HPA059934)