Anti SMARCA1 pAb (ATL-HPA064712)

Atlas Antibodies

Catalog No.: ATL-HPA064712-25

Protein Description: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 1
Gene Name: SMARCA1
Alternative Gene Name: hSNF2L, ISWI, NURF140, SNF2L, SNF2L1, SNF2LB, SWI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031099: 90%, ENSRNOG00000003762: 88%
Entrez Gene ID: 6594
Uniprot ID: P28370
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KGEKKKEKNVSSFQLKLAAKAPKSEKEMDPEYEEKMKADRAKRFEFLLKQ
• Gene Sequence: KGEKKKEKNVSSFQLKLAAKAPKSEKEMDPEYEEKMKADRAKRFEFLLKQ
• Gene ID - Mouse: ENSMUSG00000031099
• Gene ID - Rat: ENSRNOG00000003762
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.