Anti SMARCA1 pAb (ATL-HPA064712)

Atlas Antibodies

Catalog No.:
ATL-HPA064712-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 1
Gene Name: SMARCA1
Alternative Gene Name: hSNF2L, ISWI, NURF140, SNF2L, SNF2L1, SNF2LB, SWI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031099: 90%, ENSRNOG00000003762: 88%
Entrez Gene ID: 6594
Uniprot ID: P28370
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KGEKKKEKNVSSFQLKLAAKAPKSEKEMDPEYEEKMKADRAKRFEFLLKQ
Gene Sequence KGEKKKEKNVSSFQLKLAAKAPKSEKEMDPEYEEKMKADRAKRFEFLLKQ
Gene ID - Mouse ENSMUSG00000031099
Gene ID - Rat ENSRNOG00000003762
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SMARCA1 pAb (ATL-HPA064712)
Datasheet Anti SMARCA1 pAb (ATL-HPA064712) Datasheet (External Link)
Vendor Page Anti SMARCA1 pAb (ATL-HPA064712) at Atlas Antibodies

Documents & Links for Anti SMARCA1 pAb (ATL-HPA064712)
Datasheet Anti SMARCA1 pAb (ATL-HPA064712) Datasheet (External Link)
Vendor Page Anti SMARCA1 pAb (ATL-HPA064712)