Anti SMAP2 pAb (ATL-HPA024424)

Atlas Antibodies

Catalog No.:
ATL-HPA024424-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: small ArfGAP2
Gene Name: SMAP2
Alternative Gene Name: SMAP1L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032870: 91%, ENSRNOG00000011421: 92%
Entrez Gene ID: 64744
Uniprot ID: Q8WU79
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DKYEKKKYMDRSLDINAFRKEKDDKWKRGSEPVPEKKLEPVVFEKVKMPQKKEDPQLPRKSSPKSTAPVMDLLGLDAPVACSIANSKTSNTL
Gene Sequence DKYEKKKYMDRSLDINAFRKEKDDKWKRGSEPVPEKKLEPVVFEKVKMPQKKEDPQLPRKSSPKSTAPVMDLLGLDAPVACSIANSKTSNTL
Gene ID - Mouse ENSMUSG00000032870
Gene ID - Rat ENSRNOG00000011421
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SMAP2 pAb (ATL-HPA024424)
Datasheet Anti SMAP2 pAb (ATL-HPA024424) Datasheet (External Link)
Vendor Page Anti SMAP2 pAb (ATL-HPA024424) at Atlas Antibodies

Documents & Links for Anti SMAP2 pAb (ATL-HPA024424)
Datasheet Anti SMAP2 pAb (ATL-HPA024424) Datasheet (External Link)
Vendor Page Anti SMAP2 pAb (ATL-HPA024424)