Anti SMAD6 pAb (ATL-HPA061917)

Atlas Antibodies

Catalog No.: ATL-HPA061917-25

Protein Description: SMAD family member 6
Gene Name: SMAD6
Alternative Gene Name: HsT17432, MADH6, MADH7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036867: 90%, ENSRNOG00000009173: 90%
Entrez Gene ID: 4091
Uniprot ID: O43541
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PRPMSEPGAGAGSSLLDVAEPGGPGWLPESDCETVTCCLF
• Gene Sequence: PRPMSEPGAGAGSSLLDVAEPGGPGWLPESDCETVTCCLF
• Gene ID - Mouse: ENSMUSG00000036867
• Gene ID - Rat: ENSRNOG00000009173
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.