Anti SMAD6 pAb (ATL-HPA061917)

Atlas Antibodies

Catalog No.:
ATL-HPA061917-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: SMAD family member 6
Gene Name: SMAD6
Alternative Gene Name: HsT17432, MADH6, MADH7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036867: 90%, ENSRNOG00000009173: 90%
Entrez Gene ID: 4091
Uniprot ID: O43541
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PRPMSEPGAGAGSSLLDVAEPGGPGWLPESDCETVTCCLF
Gene Sequence PRPMSEPGAGAGSSLLDVAEPGGPGWLPESDCETVTCCLF
Gene ID - Mouse ENSMUSG00000036867
Gene ID - Rat ENSRNOG00000009173
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SMAD6 pAb (ATL-HPA061917)
Datasheet Anti SMAD6 pAb (ATL-HPA061917) Datasheet (External Link)
Vendor Page Anti SMAD6 pAb (ATL-HPA061917) at Atlas Antibodies

Documents & Links for Anti SMAD6 pAb (ATL-HPA061917)
Datasheet Anti SMAD6 pAb (ATL-HPA061917) Datasheet (External Link)
Vendor Page Anti SMAD6 pAb (ATL-HPA061917)