Anti SMAD4 pAb (ATL-HPA019154 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA019154-25

Protein Description: SMAD family member 4
Gene Name: SMAD4
Alternative Gene Name: DPC4, MADH4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024515: 94%, ENSRNOG00000051965: 95%
Entrez Gene ID: 4089
Uniprot ID: Q13485
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC, ChIP-Exo-Seq
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AFDLKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSSMMVKDEYVHDFEGQPSLSTEGHSIQTIQHPPSNRASTETYSTPALLAPSESNATSTANFPNIPVASTSQPASILGGSHSEGLLQI
• Gene Sequence: AFDLKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSSMMVKDEYVHDFEGQPSLSTEGHSIQTIQHPPSNRASTETYSTPALLAPSESNATSTANFPNIPVASTSQPASILGGSHSEGLLQI
• Gene ID - Mouse: ENSMUSG00000024515
• Gene ID - Rat: ENSRNOG00000051965
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SMAD4 pAb (ATL-HPA019154 w/enhanced validation) – 1 Found

Xie, Shiwei; Zhao, Chenyang; Chen, Wei; Li, Gengwu; Xiong, Zhiwei; Tang, Xiangjun; Zhang, Fan; Xiao, Heng. Recombinant human bone morphogenetic protein 2 and 7 inhibit the degeneration of intervertebral discs by blocking the Puma-dependent apoptotic signaling. International Journal Of Biological Sciences. 17(9):2367-2379.