Anti SLX4IP pAb (ATL-HPA046372)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046372-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: SLX4IP
Alternative Gene Name: C20orf94, dJ1099D15.3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027281: 69%, ENSRNOG00000007430: 72%
Entrez Gene ID: 128710
Uniprot ID: Q5VYV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MGQAKDSIKAAESHWGLPVQKLEKVNQTQPEDTSGQQKPHPGERLKTGLLSRSPVCSCESASPCPKQSPRVAKTQQKRRNCSSAEDFDHHGRVSLGSDRLVPR |
Gene Sequence | MGQAKDSIKAAESHWGLPVQKLEKVNQTQPEDTSGQQKPHPGERLKTGLLSRSPVCSCESASPCPKQSPRVAKTQQKRRNCSSAEDFDHHGRVSLGSDRLVPR |
Gene ID - Mouse | ENSMUSG00000027281 |
Gene ID - Rat | ENSRNOG00000007430 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SLX4IP pAb (ATL-HPA046372) | |
Datasheet | Anti SLX4IP pAb (ATL-HPA046372) Datasheet (External Link) |
Vendor Page | Anti SLX4IP pAb (ATL-HPA046372) at Atlas Antibodies |
Documents & Links for Anti SLX4IP pAb (ATL-HPA046372) | |
Datasheet | Anti SLX4IP pAb (ATL-HPA046372) Datasheet (External Link) |
Vendor Page | Anti SLX4IP pAb (ATL-HPA046372) |
Citations for Anti SLX4IP pAb (ATL-HPA046372) – 1 Found |
Mangosh, Tawna L; Awadallah, Wisam N; Grabowska, Magdalena M; Taylor, Derek J. SLX4IP Promotes Telomere Maintenance in Androgen Receptor-Independent Castration-Resistant Prostate Cancer through ALT-like Telomeric PML Localization. Molecular Cancer Research : Mcr. 2021;19(2):301-316. PubMed |