Anti SLURP1 pAb (ATL-HPA050967)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050967-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: SLURP1
Alternative Gene Name: ANUP, ARS, ArsB, LY6LS, MDM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022596: 68%, ENSRNOG00000005944: 69%
Entrez Gene ID: 57152
Uniprot ID: P55000
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCN |
| Gene Sequence | KEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCN |
| Gene ID - Mouse | ENSMUSG00000022596 |
| Gene ID - Rat | ENSRNOG00000005944 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SLURP1 pAb (ATL-HPA050967) | |
| Datasheet | Anti SLURP1 pAb (ATL-HPA050967) Datasheet (External Link) |
| Vendor Page | Anti SLURP1 pAb (ATL-HPA050967) at Atlas Antibodies |
| Documents & Links for Anti SLURP1 pAb (ATL-HPA050967) | |
| Datasheet | Anti SLURP1 pAb (ATL-HPA050967) Datasheet (External Link) |
| Vendor Page | Anti SLURP1 pAb (ATL-HPA050967) |