Anti SLURP1 pAb (ATL-HPA050967)

Atlas Antibodies

Catalog No.:
ATL-HPA050967-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: secreted LY6/PLAUR domain containing 1
Gene Name: SLURP1
Alternative Gene Name: ANUP, ARS, ArsB, LY6LS, MDM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022596: 68%, ENSRNOG00000005944: 69%
Entrez Gene ID: 57152
Uniprot ID: P55000
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCN
Gene Sequence KEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCN
Gene ID - Mouse ENSMUSG00000022596
Gene ID - Rat ENSRNOG00000005944
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLURP1 pAb (ATL-HPA050967)
Datasheet Anti SLURP1 pAb (ATL-HPA050967) Datasheet (External Link)
Vendor Page Anti SLURP1 pAb (ATL-HPA050967) at Atlas Antibodies

Documents & Links for Anti SLURP1 pAb (ATL-HPA050967)
Datasheet Anti SLURP1 pAb (ATL-HPA050967) Datasheet (External Link)
Vendor Page Anti SLURP1 pAb (ATL-HPA050967)