Anti SLITRK6 pAb (ATL-HPA014513)

Atlas Antibodies

Catalog No.:
ATL-HPA014513-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: SLIT and NTRK-like family, member 6
Gene Name: SLITRK6
Alternative Gene Name: FLJ22774
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045871: 90%, ENSRNOG00000022337: 89%
Entrez Gene ID: 84189
Uniprot ID: Q9H5Y7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HHTTERPSASLYEQHMVSPMVHVYRSPSFGPKHLEEEEERNEKEGSDAKHLQRSLLEQENHSPLTGSNMKYKTTNQSTEFLSFQDASSLYRNILEKERELQQLGITEYLRKNIAQLQPDMEAHYPGAHEELKLMETLMYSRPRKVLV
Gene Sequence HHTTERPSASLYEQHMVSPMVHVYRSPSFGPKHLEEEEERNEKEGSDAKHLQRSLLEQENHSPLTGSNMKYKTTNQSTEFLSFQDASSLYRNILEKERELQQLGITEYLRKNIAQLQPDMEAHYPGAHEELKLMETLMYSRPRKVLV
Gene ID - Mouse ENSMUSG00000045871
Gene ID - Rat ENSRNOG00000022337
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLITRK6 pAb (ATL-HPA014513)
Datasheet Anti SLITRK6 pAb (ATL-HPA014513) Datasheet (External Link)
Vendor Page Anti SLITRK6 pAb (ATL-HPA014513) at Atlas Antibodies

Documents & Links for Anti SLITRK6 pAb (ATL-HPA014513)
Datasheet Anti SLITRK6 pAb (ATL-HPA014513) Datasheet (External Link)
Vendor Page Anti SLITRK6 pAb (ATL-HPA014513)