Anti SLFNL1 pAb (ATL-HPA054956)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054956-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: SLFNL1
Alternative Gene Name: FLJ23878
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047518: 95%, ENSRNOG00000009906: 94%
Entrez Gene ID: 200172
Uniprot ID: Q499Z3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TRNMEFKRGSGEYLSLAFKHHVRRYVCAFLNSEGGSLLVGVEDSGLVQGIRCSHRDEDRARLLVDSILQGFKPQIFPDAYTLTFIPVISTSETS |
Gene Sequence | TRNMEFKRGSGEYLSLAFKHHVRRYVCAFLNSEGGSLLVGVEDSGLVQGIRCSHRDEDRARLLVDSILQGFKPQIFPDAYTLTFIPVISTSETS |
Gene ID - Mouse | ENSMUSG00000047518 |
Gene ID - Rat | ENSRNOG00000009906 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SLFNL1 pAb (ATL-HPA054956) | |
Datasheet | Anti SLFNL1 pAb (ATL-HPA054956) Datasheet (External Link) |
Vendor Page | Anti SLFNL1 pAb (ATL-HPA054956) at Atlas Antibodies |
Documents & Links for Anti SLFNL1 pAb (ATL-HPA054956) | |
Datasheet | Anti SLFNL1 pAb (ATL-HPA054956) Datasheet (External Link) |
Vendor Page | Anti SLFNL1 pAb (ATL-HPA054956) |