Anti SLFNL1 pAb (ATL-HPA054956)

Atlas Antibodies

Catalog No.:
ATL-HPA054956-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: schlafen-like 1
Gene Name: SLFNL1
Alternative Gene Name: FLJ23878
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047518: 95%, ENSRNOG00000009906: 94%
Entrez Gene ID: 200172
Uniprot ID: Q499Z3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TRNMEFKRGSGEYLSLAFKHHVRRYVCAFLNSEGGSLLVGVEDSGLVQGIRCSHRDEDRARLLVDSILQGFKPQIFPDAYTLTFIPVISTSETS
Gene Sequence TRNMEFKRGSGEYLSLAFKHHVRRYVCAFLNSEGGSLLVGVEDSGLVQGIRCSHRDEDRARLLVDSILQGFKPQIFPDAYTLTFIPVISTSETS
Gene ID - Mouse ENSMUSG00000047518
Gene ID - Rat ENSRNOG00000009906
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLFNL1 pAb (ATL-HPA054956)
Datasheet Anti SLFNL1 pAb (ATL-HPA054956) Datasheet (External Link)
Vendor Page Anti SLFNL1 pAb (ATL-HPA054956) at Atlas Antibodies

Documents & Links for Anti SLFNL1 pAb (ATL-HPA054956)
Datasheet Anti SLFNL1 pAb (ATL-HPA054956) Datasheet (External Link)
Vendor Page Anti SLFNL1 pAb (ATL-HPA054956)