Anti SLFN5 pAb (ATL-HPA017760 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA017760-25

Protein Description: schlafen family member 5
Gene Name: SLFN5
Alternative Gene Name: MGC19764
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054404: 51%, ENSRNOG00000021719: 49%
Entrez Gene ID: 162394
Uniprot ID: Q08AF3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ERHGVGLDVPPIFRSHLDKMQKENHFLIFVKSWNTEAGVPLATLCSNLYHRERTSTDVMDSQEALAFLKCRTQTPTNINVSNSLGPQAAQGSVQYEGNINVSAAALFDRKRLQYLEKLNLPESTHVEFVMFSTDVSHCVKD
• Gene Sequence: ERHGVGLDVPPIFRSHLDKMQKENHFLIFVKSWNTEAGVPLATLCSNLYHRERTSTDVMDSQEALAFLKCRTQTPTNINVSNSLGPQAAQGSVQYEGNINVSAAALFDRKRLQYLEKLNLPESTHVEFVMFSTDVSHCVKD
• Gene ID - Mouse: ENSMUSG00000054404
• Gene ID - Rat: ENSRNOG00000021719
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SLFN5 pAb (ATL-HPA017760 w/enhanced validation) – 2 Found

Katsoulidis, Efstratios; Mavrommatis, Evangelos; Woodard, Jennifer; Shields, Mario A; Sassano, Antonella; Carayol, Nathalie; Sawicki, Konrad T; Munshi, Hidayatullah G; Platanias, Leonidas C. Role of interferon {alpha} (IFN{alpha})-inducible Schlafen-5 in regulation of anchorage-independent growth and invasion of malignant melanoma cells. The Journal Of Biological Chemistry. 2010;285(51):40333-41. 

Reich, Stefan; Nguyen, Chi D L; Has, Canan; Steltgens, Sascha; Soni, Himanshu; Coman, Cristina; Freyberg, Moritz; Bichler, Anna; Seifert, Nicole; Conrad, Dominik; Knobbe-Thomsen, Christiane B; Tews, Björn; Toedt, Grischa; Ahrends, Robert; Medenbach, Jan. A multi-omics analysis reveals the unfolded protein response regulon and stress-induced resistance to folate-based antimetabolites. Nature Communications. 2020;11(1):2936.