Anti SLFN13 pAb (ATL-HPA023064)

Atlas Antibodies

Catalog No.:
ATL-HPA023064-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: schlafen family member 13
Gene Name: SLFN13
Alternative Gene Name: FLJ31952
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035208: 54%, ENSRNOG00000021412: 49%
Entrez Gene ID: 146857
Uniprot ID: Q68D06
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YCRSGTSVLHMNSRQAFDFLKTKERQSKYNLINEGSPPSKIMKAVYQNISESNPAYEVFQTDTIEYGEILSFPESPSIE
Gene Sequence YCRSGTSVLHMNSRQAFDFLKTKERQSKYNLINEGSPPSKIMKAVYQNISESNPAYEVFQTDTIEYGEILSFPESPSIE
Gene ID - Mouse ENSMUSG00000035208
Gene ID - Rat ENSRNOG00000021412
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLFN13 pAb (ATL-HPA023064)
Datasheet Anti SLFN13 pAb (ATL-HPA023064) Datasheet (External Link)
Vendor Page Anti SLFN13 pAb (ATL-HPA023064) at Atlas Antibodies

Documents & Links for Anti SLFN13 pAb (ATL-HPA023064)
Datasheet Anti SLFN13 pAb (ATL-HPA023064) Datasheet (External Link)
Vendor Page Anti SLFN13 pAb (ATL-HPA023064)