Anti SLCO4C1 pAb (ATL-HPA058249)
Atlas Antibodies
- Catalog No.:
- ATL-HPA058249-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: SLCO4C1
Alternative Gene Name: OATP-H, OATP4C1, OATPX, SLC21A20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040693: 71%, ENSRNOG00000022711: 71%
Entrez Gene ID: 353189
Uniprot ID: Q6ZQN7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PKHLPGTAEIQAGKTSQAHQSNSNADVKFGKSIKDFPAALKNLMK |
| Gene Sequence | PKHLPGTAEIQAGKTSQAHQSNSNADVKFGKSIKDFPAALKNLMK |
| Gene ID - Mouse | ENSMUSG00000040693 |
| Gene ID - Rat | ENSRNOG00000022711 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SLCO4C1 pAb (ATL-HPA058249) | |
| Datasheet | Anti SLCO4C1 pAb (ATL-HPA058249) Datasheet (External Link) |
| Vendor Page | Anti SLCO4C1 pAb (ATL-HPA058249) at Atlas Antibodies |
| Documents & Links for Anti SLCO4C1 pAb (ATL-HPA058249) | |
| Datasheet | Anti SLCO4C1 pAb (ATL-HPA058249) Datasheet (External Link) |
| Vendor Page | Anti SLCO4C1 pAb (ATL-HPA058249) |