Anti SLCO3A1 pAb (ATL-HPA066327)

Atlas Antibodies

Catalog No.:
ATL-HPA066327-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: solute carrier organic anion transporter family member 3A1
Gene Name: SLCO3A1
Alternative Gene Name: OATP-D, OATP3A1, SLC21A11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025790: 94%, ENSRNOG00000032798: 94%
Entrez Gene ID: 28232
Uniprot ID: Q9UIG8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LPEFLTHQYKYEAGEIRWGAEGRDVCAANGSGGDEGPDPDLICRNRTATNM
Gene Sequence LPEFLTHQYKYEAGEIRWGAEGRDVCAANGSGGDEGPDPDLICRNRTATNM
Gene ID - Mouse ENSMUSG00000025790
Gene ID - Rat ENSRNOG00000032798
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLCO3A1 pAb (ATL-HPA066327)
Datasheet Anti SLCO3A1 pAb (ATL-HPA066327) Datasheet (External Link)
Vendor Page Anti SLCO3A1 pAb (ATL-HPA066327) at Atlas Antibodies

Documents & Links for Anti SLCO3A1 pAb (ATL-HPA066327)
Datasheet Anti SLCO3A1 pAb (ATL-HPA066327) Datasheet (External Link)
Vendor Page Anti SLCO3A1 pAb (ATL-HPA066327)