Anti SLCO1A2 pAb (ATL-HPA071152)
Atlas Antibodies
- Catalog No.:
- ATL-HPA071152-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: SLCO1A2
Alternative Gene Name: OATP, OATP-A, OATP1A2, SLC21A3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063975: 65%, ENSRNOG00000010388: 63%
Entrez Gene ID: 6579
Uniprot ID: P46721
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FLPNTLPKEGLETNADIIKNENEDKQKEEVKKEKYGITKDFLPFMKSLSCN |
| Gene Sequence | FLPNTLPKEGLETNADIIKNENEDKQKEEVKKEKYGITKDFLPFMKSLSCN |
| Gene ID - Mouse | ENSMUSG00000063975 |
| Gene ID - Rat | ENSRNOG00000010388 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SLCO1A2 pAb (ATL-HPA071152) | |
| Datasheet | Anti SLCO1A2 pAb (ATL-HPA071152) Datasheet (External Link) |
| Vendor Page | Anti SLCO1A2 pAb (ATL-HPA071152) at Atlas Antibodies |
| Documents & Links for Anti SLCO1A2 pAb (ATL-HPA071152) | |
| Datasheet | Anti SLCO1A2 pAb (ATL-HPA071152) Datasheet (External Link) |
| Vendor Page | Anti SLCO1A2 pAb (ATL-HPA071152) |