Anti SLCO1A2 pAb (ATL-HPA071152)

Atlas Antibodies

Catalog No.: ATL-HPA071152-25

Protein Description: solute carrier organic anion transporter family, member 1A2
Gene Name: SLCO1A2
Alternative Gene Name: OATP, OATP-A, OATP1A2, SLC21A3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063975: 65%, ENSRNOG00000010388: 63%
Entrez Gene ID: 6579
Uniprot ID: P46721
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FLPNTLPKEGLETNADIIKNENEDKQKEEVKKEKYGITKDFLPFMKSLSCN
• Gene Sequence: FLPNTLPKEGLETNADIIKNENEDKQKEEVKKEKYGITKDFLPFMKSLSCN
• Gene ID - Mouse: ENSMUSG00000063975
• Gene ID - Rat: ENSRNOG00000010388
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.