Anti SLCO1A2 pAb (ATL-HPA071152)

Atlas Antibodies

Catalog No.:
ATL-HPA071152-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: solute carrier organic anion transporter family, member 1A2
Gene Name: SLCO1A2
Alternative Gene Name: OATP, OATP-A, OATP1A2, SLC21A3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063975: 65%, ENSRNOG00000010388: 63%
Entrez Gene ID: 6579
Uniprot ID: P46721
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FLPNTLPKEGLETNADIIKNENEDKQKEEVKKEKYGITKDFLPFMKSLSCN
Gene Sequence FLPNTLPKEGLETNADIIKNENEDKQKEEVKKEKYGITKDFLPFMKSLSCN
Gene ID - Mouse ENSMUSG00000063975
Gene ID - Rat ENSRNOG00000010388
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLCO1A2 pAb (ATL-HPA071152)
Datasheet Anti SLCO1A2 pAb (ATL-HPA071152) Datasheet (External Link)
Vendor Page Anti SLCO1A2 pAb (ATL-HPA071152) at Atlas Antibodies

Documents & Links for Anti SLCO1A2 pAb (ATL-HPA071152)
Datasheet Anti SLCO1A2 pAb (ATL-HPA071152) Datasheet (External Link)
Vendor Page Anti SLCO1A2 pAb (ATL-HPA071152)