Anti SLC9A9 pAb (ATL-HPA058234)

Atlas Antibodies

Catalog No.:
ATL-HPA058234-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: solute carrier family 9, subfamily A (NHE9, cation proton antiporter 9), member 9
Gene Name: SLC9A9
Alternative Gene Name: FLJ35613, NHE9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031129: 85%, ENSRNOG00000008554: 87%
Entrez Gene ID: 285195
Uniprot ID: Q8IVB4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TDIESGTVYDCVKLTFSPSTLLVNITDQVYEYKYKREISQHNINPHQGNAIL
Gene Sequence TDIESGTVYDCVKLTFSPSTLLVNITDQVYEYKYKREISQHNINPHQGNAIL
Gene ID - Mouse ENSMUSG00000031129
Gene ID - Rat ENSRNOG00000008554
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC9A9 pAb (ATL-HPA058234)
Datasheet Anti SLC9A9 pAb (ATL-HPA058234) Datasheet (External Link)
Vendor Page Anti SLC9A9 pAb (ATL-HPA058234) at Atlas Antibodies

Documents & Links for Anti SLC9A9 pAb (ATL-HPA058234)
Datasheet Anti SLC9A9 pAb (ATL-HPA058234) Datasheet (External Link)
Vendor Page Anti SLC9A9 pAb (ATL-HPA058234)