Anti SLC9A6 pAb (ATL-HPA059590 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA059590-25

• 
• 

Protein Description: solute carrier family 9, subfamily A (NHE6, cation proton antiporter 6), member 6
Gene Name: SLC9A6
Alternative Gene Name: KIAA0267, NHE6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060681: 97%, ENSRNOG00000000879: 97%
Entrez Gene ID: 10479
Uniprot ID: Q92581
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GGTTAMLSCLHIRVGVDSDQEHLGVPENERRTTKAESAW
• Gene Sequence: GGTTAMLSCLHIRVGVDSDQEHLGVPENERRTTKAESAW
• Gene ID - Mouse: ENSMUSG00000060681
• Gene ID - Rat: ENSRNOG00000000879
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.