Anti SLC8A1 pAb (ATL-HPA070007)

Atlas Antibodies

Catalog No.:
ATL-HPA070007-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: solute carrier family 8 (sodium/calcium exchanger), member 1
Gene Name: SLC8A1
Alternative Gene Name: NCX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054640: 93%, ENSRNOG00000008479: 90%
Entrez Gene ID: 6546
Uniprot ID: P32418
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RHAADQARKAVSMHEVNTEVTENDPVSKIFFEQGTYQCLE
Gene Sequence RHAADQARKAVSMHEVNTEVTENDPVSKIFFEQGTYQCLE
Gene ID - Mouse ENSMUSG00000054640
Gene ID - Rat ENSRNOG00000008479
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC8A1 pAb (ATL-HPA070007)
Datasheet Anti SLC8A1 pAb (ATL-HPA070007) Datasheet (External Link)
Vendor Page Anti SLC8A1 pAb (ATL-HPA070007) at Atlas Antibodies

Documents & Links for Anti SLC8A1 pAb (ATL-HPA070007)
Datasheet Anti SLC8A1 pAb (ATL-HPA070007) Datasheet (External Link)
Vendor Page Anti SLC8A1 pAb (ATL-HPA070007)