Anti SLC7A6OS pAb (ATL-HPA041533 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA041533-25

Protein Description: solute carrier family 7, member 6 opposite strand
Gene Name: SLC7A6OS
Alternative Gene Name: FLJ13291
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033106: 73%, ENSRNOG00000020049: 73%
Entrez Gene ID: 84138
Uniprot ID: Q96CW6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AEALVLACKRLRSDAVESAAQKTSEGLERAAENNVFHLVATVCSQEEPVQPLLREVLRPSRDSQQRVRRNLRASAREVRQEGRYRVLS
• Gene Sequence: AEALVLACKRLRSDAVESAAQKTSEGLERAAENNVFHLVATVCSQEEPVQPLLREVLRPSRDSQQRVRRNLRASAREVRQEGRYRVLS
• Gene ID - Mouse: ENSMUSG00000033106
• Gene ID - Rat: ENSRNOG00000020049
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SLC7A6OS pAb (ATL-HPA041533 w/enhanced validation) – 1 Found

Andeen, Nicole K; Yang, Han-Yin; Dai, Dao-Fu; MacCoss, Michael J; Smith, Kelly D. DnaJ Homolog Subfamily B Member 9 Is a Putative Autoantigen in Fibrillary GN. Journal Of The American Society Of Nephrology : Jasn. 2018;29(1):231-239.