Anti SLC7A6 pAb (ATL-HPA050713)

Atlas Antibodies

Catalog No.:
ATL-HPA050713-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: solute carrier family 7 (amino acid transporter light chain, y+L system), member 6
Gene Name: SLC7A6
Alternative Gene Name: KIAA0245, LAT-2, LAT3, y+LAT-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031904: 66%, ENSRNOG00000019943: 70%
Entrez Gene ID: 9057
Uniprot ID: Q92536
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MEAREPGRPTPTYHLVPNTSQSQVEEDVSSPPQRSSETMQLKKE
Gene Sequence MEAREPGRPTPTYHLVPNTSQSQVEEDVSSPPQRSSETMQLKKE
Gene ID - Mouse ENSMUSG00000031904
Gene ID - Rat ENSRNOG00000019943
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC7A6 pAb (ATL-HPA050713)
Datasheet Anti SLC7A6 pAb (ATL-HPA050713) Datasheet (External Link)
Vendor Page Anti SLC7A6 pAb (ATL-HPA050713) at Atlas Antibodies

Documents & Links for Anti SLC7A6 pAb (ATL-HPA050713)
Datasheet Anti SLC7A6 pAb (ATL-HPA050713) Datasheet (External Link)
Vendor Page Anti SLC7A6 pAb (ATL-HPA050713)