Anti SLC7A6 pAb (ATL-HPA050713)

Atlas Antibodies

SKU: ATL-HPA050713-25

• 
• 

Protein Description: solute carrier family 7 (amino acid transporter light chain, y+L system), member 6
Gene Name: SLC7A6
Alternative Gene Name: KIAA0245, LAT-2, LAT3, y+LAT-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031904: 66%, ENSRNOG00000019943: 70%
Entrez Gene ID: 9057
Uniprot ID: Q92536
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MEAREPGRPTPTYHLVPNTSQSQVEEDVSSPPQRSSETMQLKKE
• Gene Sequence: MEAREPGRPTPTYHLVPNTSQSQVEEDVSSPPQRSSETMQLKKE
• Gene ID - Mouse: ENSMUSG00000031904
• Gene ID - Rat: ENSRNOG00000019943
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.