Anti SLC7A5 pAb (ATL-HPA052673)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052673-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: SLC7A5
Alternative Gene Name: CD98, D16S469E, E16, LAT1, MPE16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040010: 69%, ENSRNOG00000018824: 69%
Entrez Gene ID: 8140
Uniprot ID: Q01650
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNI |
| Gene Sequence | AEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNI |
| Gene ID - Mouse | ENSMUSG00000040010 |
| Gene ID - Rat | ENSRNOG00000018824 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SLC7A5 pAb (ATL-HPA052673) | |
| Datasheet | Anti SLC7A5 pAb (ATL-HPA052673) Datasheet (External Link) |
| Vendor Page | Anti SLC7A5 pAb (ATL-HPA052673) at Atlas Antibodies |
| Documents & Links for Anti SLC7A5 pAb (ATL-HPA052673) | |
| Datasheet | Anti SLC7A5 pAb (ATL-HPA052673) Datasheet (External Link) |
| Vendor Page | Anti SLC7A5 pAb (ATL-HPA052673) |
| Citations for Anti SLC7A5 pAb (ATL-HPA052673) – 3 Found |
| Abbas, Ahmed; Beamish, Christine; McGirr, Rebecca; Demarco, John; Cockburn, Neil; Krokowski, Dawid; Lee, Ting-Yim; Kovacs, Michael; Hatzoglou, Maria; Dhanvantari, Savita. Characterization of 5-(2- (18)F-fluoroethoxy)-L-tryptophan for PET imaging of the pancreas. F1000research. 5( 27909574):1851. PubMed |
| Ohshima, Makiko; Kamei, Shota; Fushimi, Hideo; Mima, Shinji; Yamada, Tadanori; Yamamoto, Takeshi. Prediction of Drug Permeability Using In Vitro Blood-Brain Barrier Models with Human Induced Pluripotent Stem Cell-Derived Brain Microvascular Endothelial Cells. Bioresearch Open Access. 8(1):200-209. PubMed |
| Saito, Yasuhiro; Matsuda, Shiori; Ohnishi, Naomi; Endo, Keiko; Ashitani, Sanae; Ohishi, Maki; Ueno, Ayano; Tomita, Masaru; Ueda, Koji; Soga, Tomoyoshi; Muthuswamy, Senthil K. Polarity protein SCRIB interacts with SLC3A2 to regulate proliferation and tamoxifen resistance in ER+ breast cancer. Communications Biology. 2022;5(1):403. PubMed |