Anti SLC6A7 pAb (ATL-HPA028907)

Atlas Antibodies

Catalog No.: ATL-HPA028907-25

Protein Description: solute carrier family 6 (neurotransmitter transporter), member 7
Gene Name: SLC6A7
Alternative Gene Name: PROT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052026: 88%, ENSRNOG00000018644: 89%
Entrez Gene ID: 6534
Uniprot ID: Q99884
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SLTSDLPWEHCGNWWNTELCLEHRVSKDGNGALPLNLTCTVSPSEEYWSRYVLHIQGSQGIGSPG
• Gene Sequence: SLTSDLPWEHCGNWWNTELCLEHRVSKDGNGALPLNLTCTVSPSEEYWSRYVLHIQGSQGIGSPG
• Gene ID - Mouse: ENSMUSG00000052026
• Gene ID - Rat: ENSRNOG00000018644
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.