Anti SLC5A10 pAb (ATL-HPA052014)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052014-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: SLC5A10
Alternative Gene Name: SGLT5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042371: 77%, ENSRNOG00000002616: 70%
Entrez Gene ID: 125206
Uniprot ID: A0PJK1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PQSVQIENLTWWTLAQDVPLGTKAGDGQTP |
Gene Sequence | PQSVQIENLTWWTLAQDVPLGTKAGDGQTP |
Gene ID - Mouse | ENSMUSG00000042371 |
Gene ID - Rat | ENSRNOG00000002616 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SLC5A10 pAb (ATL-HPA052014) | |
Datasheet | Anti SLC5A10 pAb (ATL-HPA052014) Datasheet (External Link) |
Vendor Page | Anti SLC5A10 pAb (ATL-HPA052014) at Atlas Antibodies |
Documents & Links for Anti SLC5A10 pAb (ATL-HPA052014) | |
Datasheet | Anti SLC5A10 pAb (ATL-HPA052014) Datasheet (External Link) |
Vendor Page | Anti SLC5A10 pAb (ATL-HPA052014) |