Anti SLC5A10 pAb (ATL-HPA052014)

Atlas Antibodies

Catalog No.:
ATL-HPA052014-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: solute carrier family 5 (sodium/sugar cotransporter), member 10
Gene Name: SLC5A10
Alternative Gene Name: SGLT5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042371: 77%, ENSRNOG00000002616: 70%
Entrez Gene ID: 125206
Uniprot ID: A0PJK1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PQSVQIENLTWWTLAQDVPLGTKAGDGQTP
Gene Sequence PQSVQIENLTWWTLAQDVPLGTKAGDGQTP
Gene ID - Mouse ENSMUSG00000042371
Gene ID - Rat ENSRNOG00000002616
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC5A10 pAb (ATL-HPA052014)
Datasheet Anti SLC5A10 pAb (ATL-HPA052014) Datasheet (External Link)
Vendor Page Anti SLC5A10 pAb (ATL-HPA052014) at Atlas Antibodies

Documents & Links for Anti SLC5A10 pAb (ATL-HPA052014)
Datasheet Anti SLC5A10 pAb (ATL-HPA052014) Datasheet (External Link)
Vendor Page Anti SLC5A10 pAb (ATL-HPA052014)